[ENABLE FILTERS]
Total notifications: 617 of which 141 single ip and 476 mass defacements
Legend:
H - Homepage defacement
M - Mass defacement (click to view all defacements of this IP)
R - Redefacement (click to view all defacements of this site)
L - IP address location
- Special defacement (special defacements are important websites)
| Date | Notifier | H | M | R | L | |
Domain | OS | View |
| 2010/07/30 | KhantastiC | H | M | srivivekanandhsjlrjn.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.umiyaschool.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | vadasadaschool.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | vasundharaschool.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | bestvidhyalaya.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | mkchandaranahighschool.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.shreyasvidyalaya.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.shribharatividyalaya.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.shrikrushnavidyalay.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.snvgorwa.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.stjosephschoolbaroda.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.stpaulseng.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.stpaulsguj.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.ubashram.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.ajdghsgamdi.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | anvmpania.org | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.bmnjubhszalod.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.bpagrawallimdi.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | djmsdadur.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | frshahhsbandibar.org | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.gsvkarath.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | sfhadakanyavidhyalayakatwara.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.igmschool.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.ikdesaihighschool.com | Win 2008 | mirror | |||
| 2010/07/30 | KhantastiC | H | M | www.jalarammaschoolfatepura.com | Win 2008 | mirror | |||
| 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 | |||||||||
| DISCLAIMER: all the information contained in Zone-H's cybercrime archive were either collected online from public sources or directly notified anonymously to us. Zone-H is neither responsible for the reported computer crimes nor it is directly or indirectly involved with them. You might find some offensive contents in the mirrored defacements. Zone-H didn't produce them so we cannot be responsible for such contents. Read more | |||||||||